OVA(241-270),cas2648610-97-1
Ovalbumin(241-270)
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-M2-10818 | 25mg | 919.00 | + Add to cart |
|
| R-M2-10818 | 50mg | 1529.00 | + Add to cart |
|
|
|
||||
Product description
OVA(241-270),cas2648610-97-1/Ovalbumin(241-270) is a non-specific cytotoxic T lymphocyte (CTL) long peptide derived from ovalbumin and is a commonly used model antigen peptide in immunological research. It is widely used in immunological research scenarios such as antigen presentation mechanisms, CTL immune activation, and tumor immunotherapy.
| Appearance | N/A |
|---|---|
| Molecular Weight | 3421.90 Da |
| Solubility | Water |
| Purity | >90% |
| Molecular formula | C₁₅₄H₂₄₆N₃₄O₅₁S₁ |
| Cas | 2648610-97-1 |
| Single letter sequence | SMLVLLPDEVSGLEQLESIINFEKLTEWTS,total:30 amino acid residues. |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 1-3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of OVA(241-270),cas2648610-97-1
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


